PDB entry 4ma8

View 4ma8 on RCSB PDB site
Description: Crystal structure of mouse prion protein complexed with Chlorpromazine
Class: immune system
Keywords: Immunoglobulin fold, Fab, Antibody, Mouse prion protein, IMMUNE SYSTEM
Deposited on 2013-08-15, released 2014-01-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.197
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: major prion protein
    Species: Mus musculus [TaxId:10090]
    Gene: Prnp, Prn-p, Prp
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: POM1 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4MA8 (0-217)
  • Chain 'L':
    Compound: POM1 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4MA8 (0-212)
    Domains in SCOPe 2.06: d4ma8l1, d4ma8l2
  • Heterogens: Z80, HOH

PDB Chain Sequences:

  • Chain 'C':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ma8L (L:)
    divltqspailsvspgervsfscrasqnigtsihwyqqrtnesprliikyasesisgips
    rfsgsgsgtdftlsinsvesediadyycqqsntwpytfgggtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnsetdqdskdstysmsstlt
    ltkdeyerhntytceathktstspivksfnrne