PDB entry 4m9p

View 4m9p on RCSB PDB site
Description: Crystal structure of the human filamin A Ig-like domains 3-5
Class: cell adhesion
Keywords: cytoskeleton, actin binding, immunoglobulin-like fold, CELL ADHESION
Deposited on 2013-08-15, released 2014-02-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.201
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Filamin-A
    Species: Homo sapiens [TaxId:9606]
    Gene: FLN, FLN1, FLNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4m9pa1, d4m9pa2, d4m9pa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m9pA (A:)
    smcnpsacravgrglqpkgvrvketadfkvytkgagsgelkvtvkgpkgeervkqkdlgd
    gvygfeyypmvpgtyivtitwggqnigrspfevkvgtecgnqkvrawgpgleggvvgksa
    dfvveaigddvgtlgfsvegpsqakiecddkgdgscdvrywpqeageyavhvlcnsedir
    lspfmadirdapqdfhpdrvkargpglektgvavnkpaeftvdakhggkaplrvqvqdne
    gcpvealvkdngngtyscsyvprkpvkhtamvswggvsipnspfrvnvgag
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m9pA (A:)
    cnpsacravgrglqpkgvrvketadfkvytkgagsgelkvtvkgpkgeervkqkdlgdgv
    ygfeyypmvpgtyivtitwggqnigrspfevkvgtecgnqkvrawgpgleggvvgksadf
    vveaigddvgtlgfsvegpsqakiecddkgdgscdvrywpqeageyavhvlcnsedirls
    pfmadirdapqdfhpdrvkargpglektgvavnkpaeftvdakhggkaplrvqvqdnegc
    pvealvkdngngtyscsyvprkpvkhtamvswggvsipnspfrvnvgag