PDB entry 4m8v

View 4m8v on RCSB PDB site
Description: Crystal structure of Human double mutant beta2-microglobulin Q8H-L65T
Class: Immune system
Keywords: Immune system
Deposited on 2013-08-14, released 2014-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-15, with a file datestamp of 2014-10-10.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.196
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-99)
      • expression tag (0)
      • engineered mutation (8)
      • engineered mutation (65)
    Domains in SCOPe 2.06: d4m8va1, d4m8va2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • engineered mutation (8)
      • engineered mutation (65)
    Domains in SCOPe 2.06: d4m8vb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4m8vA (A:)
    miqrtpkihvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyltyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4m8vB (B:)
    miqrtpkihvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyltyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m8vB (B:)
    iqrtpkihvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw
    sfyltyyteftptekdeyacrvnhvtlsqpkivkwdr