PDB entry 4m7o

View 4m7o on RCSB PDB site
Description: The crystal structure of a possible an iron-binding (periplasmic solute-binding) protein from Staphylococcus epidermidis ATCC 12228.
Class: Iron binding protein
Keywords: structural genomics, PSI-Biology, protein structure initiative, midwest center for structural genomics, MCSG, Iron binding protein
Deposited on 2013-08-12, released 2013-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.183
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron-binding protein
    Species: Staphylococcus epidermidis [TaxId:176280]
    Gene: SE_0383
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m7oa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m7oA (A:)
    snaqdanhssnnkdteksdkkyhriislipsnteilyrlgigedivgvstvddypkdvkk
    gkkqfdamnlnkeelikakpdlilahesqknsagkvlkslkdkgvkvvyvkdaqsidety
    dtfksigqltdrekqakelvdetkhnvdkiinsvpkhhkkqevfmevsskpdiytagkdt
    ffndmlekldaknsfddvkgwksvskesiikrnpdilistegksksdyiemikkrggfdk
    inavkntrietvdgdevsrpgprideglkdlrddiykk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m7oA (A:)
    kkyhriislipsnteilyrlgigedivgvstvddypkdvkkgkkqfdamnlnkeelikak
    pdlilahesqknsagkvlkslkdkgvkvvyvkdaqsidetydtfksigqltdrekqakel
    vdetkhnvdkiinsvpkhhkkqevfmevsskpdiytagkdtffndmlekldaknsfddvk
    gwksvskesiikrnpdilistegksksdyiemikkrggfdkinavkntrietvdgdevsr
    pgprideglkdlrddiyk