PDB entry 4m7k

View 4m7k on RCSB PDB site
Description: Crystal structure of anti-tissue factor antibody 10H10
Class: immune system
Keywords: antibody, IMMUNE SYSTEM
Deposited on 2013-08-12, released 2014-03-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-03-26, with a file datestamp of 2014-03-21.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.206
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: 10H10 heavy chain
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4M7K (0-228)
  • Chain 'L':
    Compound: 10H10 light chain
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4M7K (0-219)
    Domains in SCOPe 2.03: d4m7kl1, d4m7kl2
  • Heterogens: CA, ACT, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4m7kL (L:)
    divmtqspssltvtagekvtmsckssqsllssgnqknyltwyqqipgqppklliywastr
    esgvpdrftgsgsgtdftltinsvqaedlavyycqndytypltfgagtklelkrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfnrgec