PDB entry 4m7j

View 4m7j on RCSB PDB site
Description: Crystal structure of S25-26 in complex with Kdo(2.8)Kdo(2.4)Kdo trisaccharide
Class: immune system
Keywords: Beta-Sandwich, Carbohydrate/Sugar Binding, IMMUNE SYSTEM
Deposited on 2013-08-12, released 2014-04-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.213
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: S25-26 Fab (Igg1k) Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4M7J (0-218)
  • Chain 'L':
    Compound: S25-26 Fab (Igg1k) Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4M7J (0-218)
    Domains in SCOPe 2.04: d4m7jl1, d4m7jl2
  • Heterogens: NAG, K, PEG, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4m7jL (L:)
    dilmnqtplslpvslgdqasiscrssqyivhrngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec