PDB entry 4m78

View 4m78 on RCSB PDB site
Description: Crystal structure of Lsm2-8 complex, space group P21
Class: RNA binding protein
Keywords: Sm Like Protein, RNA splicing, STRUCTURAL PROTEIN, RNA BINDING PROTEIN
Deposited on 2013-08-12, released 2013-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: 0.256
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U6 snRNA-associated Sm-like protein LSm8
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM8, YJR022W, J1464, YJR83.16
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47093 (0-End)
      • engineered mutation (16)
      • engineered mutation (21)
      • engineered mutation (37)
      • engineered mutation (50)
  • Chain 'B':
    Compound: u6 snrna-associated sm-like protein lsm2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM2, SMX5, SNP3, YBL026W, YBL0425
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38203 (0-End)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d4m78b_
  • Chain 'C':
    Compound: U6 snRNA-associated Sm-like protein LSm3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM3, SMX4, USS2, YLR438C-A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P57743
      • engineered mutation (36)
      • engineered mutation (62)
    Domains in SCOPe 2.07: d4m78c_
  • Chain 'D':
    Compound: U6 snRNA-associated Sm-like protein LSm6
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM6, YDR378C, D9481.18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m78d_
  • Chain 'E':
    Compound: U6 snRNA-associated Sm-like protein LSm5
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM5, YER146W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m78e_
  • Chain 'F':
    Compound: U6 snRNA-associated Sm-like protein LSm7
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM7, YNL147W, N1202, N1780
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m78f_
  • Chain 'G':
    Compound: u6 snrna-associated sm-like protein lsm4
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM4, SDB23, USS1, YER112W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m78g_
  • Chain 'H':
    Compound: U6 snRNA-associated Sm-like protein LSm8
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM8, YJR022W, J1464, YJR83.16
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47093 (0-End)
      • engineered mutation (16)
      • engineered mutation (21)
      • engineered mutation (37)
      • engineered mutation (50)
  • Chain 'I':
    Compound: u6 snrna-associated sm-like protein lsm2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM2, SMX5, SNP3, YBL026W, YBL0425
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38203 (0-End)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d4m78i_
  • Chain 'J':
    Compound: U6 snRNA-associated Sm-like protein LSm3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM3, SMX4, USS2, YLR438C-A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P57743
      • engineered mutation (36)
      • engineered mutation (62)
    Domains in SCOPe 2.07: d4m78j_
  • Chain 'K':
    Compound: U6 snRNA-associated Sm-like protein LSm6
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM6, YDR378C, D9481.18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m78k_
  • Chain 'L':
    Compound: U6 snRNA-associated Sm-like protein LSm5
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM5, YER146W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m78l_
  • Chain 'M':
    Compound: U6 snRNA-associated Sm-like protein LSm7
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM7, YNL147W, N1202, N1780
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m78m_
  • Chain 'N':
    Compound: u6 snrna-associated sm-like protein lsm4
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: LSM4, SDB23, USS1, YER112W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m78n_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4m78B (B:)
    mlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisstdekkyphlgsvrni
    firgstvryvylnknmvdtnllqdatrrevmterk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m78B (B:)
    mlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisstyphlgsvrnifirg
    stvryvylnknmvdtnllqdatrrevm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4m78C (C:)
    metpldllklnldervyiklrgartlvgtlqafdshsnivlsdavetiyqlnneelsese
    rrsemvfirgdtvtlistpsedddgavei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m78C (C:)
    tpldllklnldervyiklrgartlvgtlqafdshsnivlsdavetiyqlnneelseserr
    semvfirgdtvtlistp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4m78D (D:)
    msgkastegsvtteflsdiigktvnvklasgllysgrlesidgfmnvalssatehyesnn
    nkllnkfnsdvflrgtqvmyiseqki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m78D (D:)
    svtteflsdiigktvnvklasgllysgrlesidgfmnvalssatehyesnnnkllnkfns
    dvflrgtqvmyiseq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4m78E (E:)
    mslpeilplevidktinqkvlivlqsnrefegtlvgfddfvnviledavewlidpedesr
    nekvmqhhgrmllsgnniailvpggkktpteal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m78E (E:)
    ilplevidktinqkvlivlqsnrefegtlvgfddfvnviledavewlidnekvmqhhgrm
    llsgnniailvpg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4m78F (F:)
    mhqqhsksenkpqqqrkkfegpkreaildlakykdskirvklmggklvigvlkgydqlmn
    lvlddtveymsnpddenntelisknarklgltvirgtilvslssaegsdvlymqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m78F (F:)
    ildlakykdskirvklmggklvigvlkgydqlmnlvlddtveymnarklgltvirgtilv
    slssa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4m78G (G:)
    mlplylltnakgqqmqielkngeiiqgiltnvdnwmnltlsnvteyseesainsednaes
    skavklneiyirgtfikfiklqdniidkvkqqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m78G (G:)
    mlplylltnakgqqmqielkngeiiqgiltnvdnwmnltlsnvteysvklneiyirgtfi
    kfiklqdnii
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4m78I (I:)
    mlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisstdekkyphlgsvrni
    firgstvryvylnknmvdtnllqdatrrevmterk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m78I (I:)
    mlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnissphlgsvrnifirgst
    vryvylnknmvdtnllqdatrrevm
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4m78J (J:)
    metpldllklnldervyiklrgartlvgtlqafdshsnivlsdavetiyqlnneelsese
    rrsemvfirgdtvtlistpsedddgavei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m78J (J:)
    tpldllklnldervyiklrgartlvgtlqafdshsnivlsdavetiyqlnneelseserr
    semvfirgdtvtlistp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4m78K (K:)
    msgkastegsvtteflsdiigktvnvklasgllysgrlesidgfmnvalssatehyesnn
    nkllnkfnsdvflrgtqvmyiseqki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m78K (K:)
    vtteflsdiigktvnvklasgllysgrlesidgfmnvalssatehyesnnnkllnkfnsd
    vflrgtqvmyiseq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4m78L (L:)
    mslpeilplevidktinqkvlivlqsnrefegtlvgfddfvnviledavewlidpedesr
    nekvmqhhgrmllsgnniailvpggkktpteal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m78L (L:)
    peilplevidktinqkvlivlqsnrefegtlvgfddfvnviledavewlidnekvmqhhg
    rmllsgnniailvpg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4m78M (M:)
    mhqqhsksenkpqqqrkkfegpkreaildlakykdskirvklmggklvigvlkgydqlmn
    lvlddtveymsnpddenntelisknarklgltvirgtilvslssaegsdvlymqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m78M (M:)
    ildlakykdskirvklmggklvigvlkgydqlmnlvlddtveymnarklgltvirgtilv
    slssa
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4m78N (N:)
    mlplylltnakgqqmqielkngeiiqgiltnvdnwmnltlsnvteyseesainsednaes
    skavklneiyirgtfikfiklqdniidkvkqqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m78N (N:)
    mlplylltnakgqqmqielkngeiiqgiltnvdnwmnltlsnvteysvklneiyirgtfi
    kfiklqdniid