PDB entry 4m6o

View 4m6o on RCSB PDB site
Description: Crystal structure of anti-NGF antibody CNTO7309
Class: immune system
Keywords: immunoglobulin fold, antibody, IMMUNE SYSTEM
Deposited on 2013-08-09, released 2014-03-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-03-26, with a file datestamp of 2014-03-21.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.189
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: CNTO7309 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4M6O (0-End)
  • Chain 'L':
    Compound: CNTO7309 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4M6O (0-213)
    Domains in SCOPe 2.03: d4m6ol1, d4m6ol2
  • Heterogens: MES, SO4, NI, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4m6oL (L:)
aiqltqspsslsasvgdrvtitcrasqgissalawyqqkpgkapklliydasslesgvps
rfsgsgsgtdftltisslqpedfatyycqqfnsypltfgggtkveikrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnrgec