PDB entry 4m6m

View 4m6m on RCSB PDB site
Description: Crystal structure of anti-IL-23 antibody CNTO1959 at pH 9.5
Class: immune system
Keywords: immunoglobulin fold, antibody, IMMUNE SYSTEM
Deposited on 2013-08-09, released 2014-03-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-29, with a file datestamp of 2015-04-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: CNTO1959 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4M6M (0-End)
  • Chain 'L':
    Compound: CNTO1959 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4M6M (0-End)
    Domains in SCOPe 2.07: d4m6ml1, d4m6ml2
  • Heterogens: GOL, MLA, PEG, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4m6mL (L:)
    qsvltqppsvsgapgqrvtisctgsssnigsgydvhwyqqlpgtapklliygnskrpsgv
    pdrfsgsksgtsaslaitglqsedeadyycaswtdglslvvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m6mL (L:)
    qsvltqppsvsgapgqrvtisctgsssnigsgydvhwyqqlpgtapklliygnskrpsgv
    pdrfsgsksgtsaslaitglqsedeadyycaswtdglslvvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptec