PDB entry 4m61

View 4m61 on RCSB PDB site
Description: Crystal structure of unliganded anti-DNA Fab A52
Class: immune system
Keywords: immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2013-08-08, released 2013-08-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-08-06, with a file datestamp of 2014-08-01.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: 0.196
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab A52 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4M61 (0-218)
    Domains in SCOPe 2.06: d4m61a1, d4m61a2
  • Chain 'B':
    Compound: Fab A52 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4M61 (0-219)
  • Chain 'C':
    Compound: Fab A52 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4M61 (0-218)
    Domains in SCOPe 2.06: d4m61c1, d4m61c2
  • Chain 'D':
    Compound: Fab A52 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4M61 (0-219)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4m61A (A:)
    nimmtqspsslavsagekvtmsckssqsvlyssnqknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyychqhlsswtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathatstspivksfnrnec
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4m61C (C:)
    nimmtqspsslavsagekvtmsckssqsvlyssnqknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyychqhlsswtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathatstspivksfnrnec
    

  • Chain 'D':
    No sequence available.