PDB entry 4m56

View 4m56 on RCSB PDB site
Description: The Structure of Wild-type MalL from Bacillus subtilis
Class: hydrolase
Keywords: TIM barrel, Glucosidase, HYDROLASE
Deposited on 2013-08-08, released 2013-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oligo-1,6-glucosidase 1
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: malL, yvdL, BSU34560
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m56a1, d4m56a2
  • Chain 'B':
    Compound: Oligo-1,6-glucosidase 1
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: malL, yvdL, BSU34560
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4m56b1, d4m56b2
  • Heterogens: GLO, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m56A (A:)
    msewwkeavvyqiyprsfydangdgfgdlqgviqkldyiknlgadviwlspvfdspqddn
    gydisdyknmyekfgtnedmfqlidevhkrgmkivmdlvvnhtsdehawfaesrkskdnp
    yrdyylwkdpkpdgsepnnwgsifsgsawtydegtgqyylhyfskkqpdlnweneavrre
    vydvmrfwmdrgvdgwrmdvigsiskytdfpdyetdhsrsyivgryhsngprlhefiqem
    nrevlshydcmtvgeangsdieeakkytdasrqelnmiftfehmdidkeqnspngkwqik
    pfdlialkktmtrwqtglmnvgwntlyfenhdqprvisrwgndrklrkecakafatvlhg
    mkgtpfiyqgeeigmvnsdmplemyddleiknayrelvvenktmsekefvkavmikgrdh
    artpmqwdagkhagftagdpwipvnsryqdinvkesledqdsiffyyqkliqlrkqykim
    iygdyqllqendpqvfsylreyrgekllvvvnlseekalfeappeliherwkvlisnypq
    eradlksislkpyeavmgisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m56A (A:)
    ewwkeavvyqiyprsfydangdgfgdlqgviqkldyiknlgadviwlspvfdspqddngy
    disdyknmyekfgtnedmfqlidevhkrgmkivmdlvvnhtsdehawfaesrkskdnpyr
    dyylwkdpkpdgsepnnwgsifsgsawtydegtgqyylhyfskkqpdlnweneavrrevy
    dvmrfwmdrgvdgwrmdvigsiskytdfpdyetrsyivgryhsngprlhefiqemnrevl
    shydcmtvgeangsdieeakkytdasrqelnmiftfehmdidkeqnspngkwqikpfdli
    alkktmtrwqtglmnvgwntlyfenhdqprvisrwgndrklrkecakafatvlhgmkgtp
    fiyqgeeigmvnsdmplemyddleiknayrelvvenktmsekefvkavmikgrdhartpm
    qwdagkhagftagdpwipvnsryqdinvkesledqdsiffyyqkliqlrkqykimiygdy
    qllqendpqvfsylreyrgekllvvvnlseekalfeappeliherwkvlisnypqradlk
    sislkpyeavmgisi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4m56B (B:)
    msewwkeavvyqiyprsfydangdgfgdlqgviqkldyiknlgadviwlspvfdspqddn
    gydisdyknmyekfgtnedmfqlidevhkrgmkivmdlvvnhtsdehawfaesrkskdnp
    yrdyylwkdpkpdgsepnnwgsifsgsawtydegtgqyylhyfskkqpdlnweneavrre
    vydvmrfwmdrgvdgwrmdvigsiskytdfpdyetdhsrsyivgryhsngprlhefiqem
    nrevlshydcmtvgeangsdieeakkytdasrqelnmiftfehmdidkeqnspngkwqik
    pfdlialkktmtrwqtglmnvgwntlyfenhdqprvisrwgndrklrkecakafatvlhg
    mkgtpfiyqgeeigmvnsdmplemyddleiknayrelvvenktmsekefvkavmikgrdh
    artpmqwdagkhagftagdpwipvnsryqdinvkesledqdsiffyyqkliqlrkqykim
    iygdyqllqendpqvfsylreyrgekllvvvnlseekalfeappeliherwkvlisnypq
    eradlksislkpyeavmgisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m56B (B:)
    ewwkeavvyqiyprsfydangdgfgdlqgviqkldyiknlgadviwlspvfdspqddngy
    disdyknmyekfgtnedmfqlidevhkrgmkivmdlvvnhtsdehawfaesrkskdnpyr
    dyylwkdpkpdgsepnnwgsifsgsawtydegtgqyylhyfskkqpdlnweneavrrevy
    dvmrfwmdrgvdgwrmdvigsiskytdfpdyetrsyivgryhsngprlhefiqemnrevl
    shydcmtvgeangsdieeakkytdasrqelnmiftfehmdidkeqnspngkwqikpfdli
    alkktmtrwqtglmnvgwntlyfenhdqprvisrwgndrklrkecakafatvlhgmkgtp
    fiyqgeeigmvnsdmplemyddleiknayrelvvenktmsekefvkavmikgrdhartpm
    qwdagkhagftagdpwipvnsryqdinvkesledqdsiffyyqkliqlrkqykimiygdy
    qllqendpqvfsylreyrgekllvvvnlseekalfeappeliherwkvlisnypqeradl
    ksislkpyeavmgisi