PDB entry 4m48

View 4m48 on RCSB PDB site
Description: X-ray structure of dopamine transporter elucidates antidepressant mechanism
Class: transport protein
Keywords: SLC6, neurotransmitter transporter, TRANSPORT PROTEIN
Deposited on 2013-08-06, released 2013-09-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 2.96 Å
R-factor: 0.223
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transporter
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: DAT, CG8380
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NB97 (Start-143)
      • engineered mutation (54)
    • Uniprot Q9NB97 (144-End)
      • engineered mutation (212)
      • engineered mutation (248)
      • engineered mutation (352)
      • engineered mutation (475)
  • Chain 'H':
    Compound: 9D5 antibody, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4M48
  • Chain 'L':
    Compound: 9D5 antibody, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4M48
    Domains in SCOPe 2.06: d4m48l1, d4m48l2
  • Heterogens: NA, CL, 21B, CLR, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4m48L (L:)
    mdfqvqifsfllisasvamsrgenvltqspaimstspgekvtmtcrasssvgssylhwyq
    qksgaspklwiystsnlasgvparfsgsgsgtsysltissveaedaatyycqqfsgyplt
    fgsgtklemkradaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqn
    gvlnswtdqdskdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m48L (L:)
    envltqspaimstspgekvtmtcrasssvgssylhwyqqksgaspklwiystsnlasgvp
    arfsgsgsgtsysltissveaedaatyycqqfsgypltfgsgtklemkradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrne