PDB entry 4m43

View 4m43 on RCSB PDB site
Description: Crystal structure of anti-rabies glycoprotein Fab 523-11
Class: immune system
Keywords: Immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2013-08-06, released 2013-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.196
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fragment antigen-binding 523-11 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4M43 (0-218)
  • Chain 'L':
    Compound: Fragment antigen-binding 523-11 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4M43 (0-212)
    Domains in SCOPe 2.07: d4m43l1, d4m43l2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4m43L (L:)
    elvmtqspailsvspgervsfscrasqiigtsihwyqqrtngsprllikyasesisgips
    rfsgsgsgtdftltinsvesddiadyycqqsnswpvtfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnraa