PDB entry 4m3k

View 4m3k on RCSB PDB site
Description: Structure of a single domain camelid antibody fragment cAb-H7S in complex with the BlaP beta-lactamase from Bacillus licheniformis
Class: hydrolase/immune system
Keywords: immunoglobulin fold, antigen binding, beta-lactamase-antibody complex, HYDROLASE-IMMUNE SYSTEM complex
Deposited on 2013-08-06, released 2014-08-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-06, with a file datestamp of 2014-08-01.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.163
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Bacillus licheniformis [TaxId:1402]
    Gene: penP, blaP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00808
      • insertion (167)
      • insertion (167)
    Domains in SCOPe 2.07: d4m3ka_
  • Chain 'B':
    Compound: Camelid heavy-chain antibody variable fragment cAb-H7S
    Species: Lama glama [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4M3K
    Domains in SCOPe 2.07: d4m3kb1, d4m3kb2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m3kA (A:)
    temkddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksie
    dlnqritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslk
    kelrkigdevtnperfepelnevnpgetqdtstaralvtslrafaledpgklpsekrell
    idwmkrnttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdk
    kdakyddkliaeatkvvmkalnmngkgphhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m3kA (A:)
    mkddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedl
    nqritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkke
    lrkigdevtnperfepelnevnpgetqdtstaralvtslrafaledpgklpsekrellid
    wmkrnttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkd
    akyddkliaeatkvvmkaln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4m3kB (B:)
    qvqlqesggglvqpggslrlscaasgsissittmgwyrqdpgkgrelvalinsvgdttya
    gsvkgrftisrdnakntvylemsslkpedtavyycnafmstnsgrtgsfwgqgtqvtvss
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m3kB (B:)
    vqlqesggglvqpggslrlscaasgsissittmgwyrqdgrelvalinsvgdttyagsvk
    grftisrdnakntvylemsslkpedtavyycnafmstnsgrtgsfwgqgtqvtvss