PDB entry 4m3j

View 4m3j on RCSB PDB site
Description: Structure of a single-domain camelid antibody fragment cAb-H7S specific of the BlaP beta-lactamase from Bacillus licheniformis
Class: immune system
Keywords: Immunoglobulin fold, Antigen binding, beta-lactamase binding antibody, IMMUNE SYSTEM
Deposited on 2013-08-06, released 2014-08-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-06, with a file datestamp of 2014-08-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.208
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Camelid heavy-chain antibody variable fragment cAb-H7S
    Species: Lama glama [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4M3J (0-End)
    Domains in SCOPe 2.07: d4m3ja1, d4m3ja2
  • Chain 'B':
    Compound: Camelid heavy-chain antibody variable fragment cAb-H7S
    Species: Lama glama [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4M3J (0-End)
    Domains in SCOPe 2.07: d4m3jb1, d4m3jb2, d4m3jb3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m3jA (A:)
    qvqlqesggglvqpggslrlscaasgsissittmgwyrqdpgkgrelvalinsvgdttya
    gsvkgrftisrdnakntvylemsslkpedtavyycnafmstnsgrtgsfwgqgtqvtvss
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m3jA (A:)
    qvqlqesggglvqpggslrlscaasgsissittmgwyrqgrelvalinsvgdttyagsvk
    grftisrdnakntvylemsslkpedtavyycnafmstnsgrtgsfwgqgtqvtvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4m3jB (B:)
    qvqlqesggglvqpggslrlscaasgsissittmgwyrqdpgkgrelvalinsvgdttya
    gsvkgrftisrdnakntvylemsslkpedtavyycnafmstnsgrtgsfwgqgtqvtvss
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m3jB (B:)
    qvqlqesggglvqpggslrlscaasgsissittmgwyrqdpgkgrelvalinsvgdttya
    gsvkgrftisrdnakntvylemsslkpedtavyycnafmstnsgrtgsfwgqgtqvtvs