PDB entry 4m35

View 4m35 on RCSB PDB site
Description: Crystal structure of gated-pore mutant H126/141D of second DNA-Binding protein under starvation from Mycobacterium smegmatis
Class: DNA binding protein
Keywords: ferritin-like fold, DNA binding, ferroxidation, Iron, DNA BINDING PROTEIN
Deposited on 2013-08-06, released 2014-03-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.176
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative starvation-induced DNA protecting protein/Ferritin and Dps
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: DPS2, MSMEG_3242, MSMEI_3159
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0QXB7 (7-167)
      • engineered mutation (132)
      • engineered mutation (147)
    Domains in SCOPe 2.04: d4m35a_
  • Chain 'B':
    Compound: Putative starvation-induced DNA protecting protein/Ferritin and Dps
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: DPS2, MSMEG_3242, MSMEI_3159
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0QXB7 (Start-167)
      • engineered mutation (132)
      • engineered mutation (147)
    Domains in SCOPe 2.04: d4m35b_
  • Chain 'C':
    Compound: Putative starvation-induced DNA protecting protein/Ferritin and Dps
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: DPS2, MSMEG_3242, MSMEI_3159
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0QXB7 (Start-167)
      • engineered mutation (132)
      • engineered mutation (147)
    Domains in SCOPe 2.04: d4m35c_
  • Chain 'D':
    Compound: Putative starvation-induced DNA protecting protein/Ferritin and Dps
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: DPS2, MSMEG_3242, MSMEI_3159
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0QXB7 (7-167)
      • engineered mutation (132)
      • engineered mutation (147)
    Domains in SCOPe 2.04: d4m35d_
  • Heterogens: FE2, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m35A (A:)
    masvglvmsarrtesdiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlh
    lqldelvdfaregsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlitt
    rinatvdtirrvddavdaedpstadlldglidglekqawlirsenrkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m35A (A:)
    msarrtesdiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlhlqldelv
    dfaregsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlittrinatvd
    tirrvddavdaedpstadlldglidglekqawlirsenrkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4m35B (B:)
    masvglvmsarrtesdiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlh
    lqldelvdfaregsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlitt
    rinatvdtirrvddavdaedpstadlldglidglekqawlirsenrkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m35B (B:)
    sarrtesdiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlhlqldelvd
    faregsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlittrinatvdt
    irrvddavdaedpstadlldglidglekqawlirsenrkv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4m35C (C:)
    masvglvmsarrtesdiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlh
    lqldelvdfaregsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlitt
    rinatvdtirrvddavdaedpstadlldglidglekqawlirsenrkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m35C (C:)
    sarrtesdiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlhlqldelvd
    faregsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlittrinatvdt
    irrvddavdaedpstadlldglidglekqawlirsenrkv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4m35D (D:)
    masvglvmsarrtesdiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlh
    lqldelvdfaregsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlitt
    rinatvdtirrvddavdaedpstadlldglidglekqawlirsenrkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m35D (D:)
    msarrtesdiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlhlqldelv
    dfaregsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlittrinatvd
    tirrvddavdaedpstadlldglidglekqawlirsenrkv