PDB entry 4m1t

View 4m1t on RCSB PDB site
Description: Crystal Structure of small molecule vinylsulfonamide 14 covalently bound to K-Ras G12C
Class: signaling protein/inhibitor
Keywords: GTPase, GDP bound, small molecule inhibitor, covalent binder, SIGNALING PROTEIN-INHIBITOR complex
Deposited on 2013-08-04, released 2013-11-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-12-18, with a file datestamp of 2013-12-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.171
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: K-Ras GTPase
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS isoform 2B, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-End)
      • variant (12)
      • engineered mutation (51)
      • engineered mutation (80)
      • engineered mutation (118)
      • see remark 999 (151)
      • see remark 999 (153)
      • see remark 999 (165-168)
    Domains in SCOPe 2.03: d4m1ta_
  • Chain 'B':
    Compound: K-Ras GTPase
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS isoform 2B, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-End)
      • variant (12)
      • engineered mutation (51)
      • engineered mutation (80)
      • engineered mutation (118)
      • see remark 999 (151)
      • see remark 999 (153)
      • see remark 999 (165-168)
    Domains in SCOPe 2.03: d4m1tb_
  • Chain 'C':
    Compound: K-Ras GTPase
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS isoform 2B, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-End)
      • variant (12)
      • engineered mutation (51)
      • engineered mutation (80)
      • engineered mutation (118)
      • see remark 999 (151)
      • see remark 999 (153)
      • see remark 999 (165-168)
    Domains in SCOPe 2.03: d4m1tc_
  • Heterogens: GDP, 21M, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m1tA (A:)
    gmteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildta
    gqeeysamrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m1tA (A:)
    mteyklvvvgacgvgksaltiqliqnhfvdiedsyrkqvvidgetslldildtagqeeys
    amrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksdlpsrtv
    dtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4m1tB (B:)
    gmteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildta
    gqeeysamrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m1tB (B:)
    mteyklvvvgacgvgksaltiqliqnhfvdedsyrkqvvidgetslldildtagqeeysa
    mrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksdlpsrtvd
    tkqaqdlarsygipfietsaktrqgvddafytlvreirkhke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4m1tC (C:)
    gmteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildta
    gqeeysamrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m1tC (C:)
    mteyklvvvgacgvgksaltiqliqnhfvsyrkqvvidgetslldildtagdqymrtgeg
    fllvfainntksfedihhyreqikrvkdsedvpmvlvgnksdlpsrtvdtkqaqdlarsy
    gipfietsaktrqgvddafytlvreirkhke