PDB entry 4m1d

View 4m1d on RCSB PDB site
Description: Crystal structure of anti-HIV-1 Fab 447-52D in complex with V3 cyclic peptide MN
Class: immune system
Keywords: hiv, v3 loop, antibody-antigen interactions, envelope, immune system
Deposited on 2013-08-02, released 2013-09-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab mAb 447-52D Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4M1D (0-230)
    Domains in SCOPe 2.06: d4m1dh1, d4m1dh2
  • Chain 'I':
    Compound: Fab mAb 447-52D Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4M1D (0-230)
    Domains in SCOPe 2.06: d4m1di1, d4m1di2
  • Chain 'L':
    Compound: Fab mAb 447-52D Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4M1D (0-215)
    Domains in SCOPe 2.06: d4m1dl1, d4m1dl2
  • Chain 'M':
    Compound: Fab mAb 447-52D Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4M1D
    Domains in SCOPe 2.06: d4m1dm1, d4m1dm2
  • Chain 'P':
    Compound: Cyclic V3 Arch Peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 4M1D (0-13)
  • Chain 'Q':
    Compound: Cyclic V3 Arch Peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 4M1D (0-13)
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4m1dH (H:)
    evqlvesggglvkpggslrltcvasgftfsdvwlnwvrqapgkglewvgriksrtdggtt
    dyaasvkgrftisrddskntlylqmnslktedtavyscttdgfimirgvsedyyyyymdv
    wgkgttvtvssastkgpsvfplapcsrstsggtaalgclvkdyfpepvtvswnsgaltsg
    vhtfpavlqssglyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvel
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4m1dI (I:)
    evqlvesggglvkpggslrltcvasgftfsdvwlnwvrqapgkglewvgriksrtdggtt
    dyaasvkgrftisrddskntlylqmnslktedtavyscttdgfimirgvsedyyyyymdv
    wgkgttvtvssastkgpsvfplapcsrstsggtaalgclvkdyfpepvtvswnsgaltsg
    vhtfpavlqssglyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvel
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4m1dL (L:)
    qsvltqppsvsaapgqkvtiscsgsssnignnyvlwyqqfpgtapklliygnnkrpsgip
    drfsgsksgtsatlgitglqtgdeadyfcatwdsglsadwvfgggtkltvlsqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptec
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4m1dM (M:)
    qsvltqppsvsaapgqkvtiscsgsssnignnyvlwyqqfpgtapklliygnnkrpsgip
    drfsgsksgtsatlgitglqtgdeadyfcatwdsglsadwvfgggtkltvlsqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m1dM (M:)
    svltqppsvsaapgqkvtiscsgsssnignnyvlwyqqfpgtapklliygnnkrpsgipd
    rfsgsksgtsatlgitglqtgdeadyfcatwdsglsadwvfgggtkltvlsqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.