PDB entry 4lz6

View 4lz6 on RCSB PDB site
Description: Structure of MATE multidrug transporter DinF-BH
Class: transport protein
Keywords: multidrug transporter, TRANSPORT PROTEIN
Deposited on 2013-07-31, released 2013-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.3
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BH2163 protein
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: BH2163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lz6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lz6A (A:)
    qkqqserlgteaipkllrslsipamigmfvmalynvvdtifisyavgiegvagvtiafpi
    mmimmsmagalgiggasvisrrlgerrgeeanqvfgniltvilvlsvigfisaftllgpa
    lqlfgatsvtqgyatdylfpillgsiffffafaanniirsegnatfamvtmivpavlnil
    ldvlfifglnmgvlgasiatviaqasvtglvlryfltgkstlslhwsdlrmkgsvikevc
    lvglpafvqqssaslmmiainsmllrfgsdfyvgvfglvqrimmfvmmpmmgimqamqpi
    vgynygakqysrlretvmlgfkvatifsigifallmlfpeallrvftadreviqagvsam
    hilfcvtfligaqivagglyqslgkpkqalilslsrqiifliplvlilphifglsgvwwa
    fpiadvlsfiltvvllyrdrnvfflk