PDB entry 4lz3

View 4lz3 on RCSB PDB site
Description: F95H Epi-isozizaene synthase: Complex with Mg, inorganic pyrophosphate and benzyl triethyl ammonium cation
Class: lyase
Keywords: LYASE, Class I terpene cyclase
Deposited on 2013-07-31, released 2013-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.164
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epi-isozizaene synthase
    Species: STREPTOMYCES COELICOLOR [TaxId:100226]
    Gene: cyc1, SCO5222, SC7E4.19
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K499
      • engineered mutation (115)
    Domains in SCOPe 2.07: d4lz3a_
  • Heterogens: GOL, MG, POP, BTM, PI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lz3A (A:)
    mgsshhhhhhssglvprgshmvhafphgttatptaiavppslrlpvieaafprqlhpywp
    klqettrtwllekrlmpadkveeyadglcytdlmagyylgapdevlqaiadysawhfvwd
    drhdrdivhgragawrrlrgllhtaldspgdhlhhedtlvagfadsvrrlyaflpatwna
    rfarhfhtvieaydrefhnrtrgivpgveeylelrrltfahwiwtdllepssgcelpdav
    rkhpayrraallsqefaawyndlcslpkeiagdevhnlgislithhsltleeaigevrrr
    veeciteflaverdalrfadeladgtvrgkelsgavranvgnmrnwfssvywfhhesgry
    mvdswddrstppyvnneaagek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lz3A (A:)
    avppslrlpvieaafprqlhpywpklqettrtwllekrlmpadkveeyadglcytdlmag
    yylgapdevlqaiadysawhfvwddrhdrdivhgragawrrlrgllhtaldspgdhlhhe
    dtlvagfadsvrrlyaflpatwnarfarhfhtvieaydrefhnrtrgivpgveeylelrr
    ltfahwiwtdllepssgcelpdavrkhpayrraallsqefaawyndlcslpkeiagdevh
    nlgislithhsltleeaigevrrrveeciteflaverdalrfadeladgtvrgkelsgav
    ranvgnmrnwfssvywfhhesgrymvdswddrstppyvnn