PDB entry 4lz2

View 4lz2 on RCSB PDB site
Description: Crystal structure of the bromodomain of human BAZ2A
Class: signaling protein
Keywords: Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2013-07-31, released 2013-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain adjacent to zinc finger domain protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2A, KIAA0314, TIP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lz2a_
  • Heterogens: EDO, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lz2A (A:)
    smhsdltfceiilmemeshdaawpflepvnprlvsgyrriiknpmdfstmrerllrggyt
    sseefaadallvfdncqtfneddsevgkaghimrrffesrweefyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lz2A (A:)
    ltfceiilmemeshdaawpflepvnprlvsgyrriiknpmdfstmrerllrggytsseef
    aadallvfdncqtfneddsevgkaghimrrffesrweefy