PDB entry 4lyr

View 4lyr on RCSB PDB site
Description: Glycoside Hydrolase Family 5 Mannosidase from Rhizomucor miehei, E301A mutant
Class: Hydrolase
Keywords: Tim Barrel, Hydrolase, extracellular protein
Deposited on 2013-07-31, released 2014-08-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.135
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exo-beta-1,4-mannosidase
    Species: Rhizomucor miehei [TaxId:4839]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LYR (Start-448)
    Domains in SCOPe 2.06: d4lyra_
  • Heterogens: TRS, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lyrA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefafvkiasdgkgftrygepylirga
    nywqgmnlgaddcsggdrkrmeleikqmaemginnlrvmassegpddqpyrmrpsmmpqp
    gkynegvfvgldylldtmdrynmtavmtlgnfwqwsggfgqyvawitgnqtipypvgdvt
    ydeftqfaarfyndseiapkanklfkdhiytvqnrrntvngkiykedpvimswqianepq
    eapaswfeeistfikkgapkhlvsagleskldeydfdrahdhknidyttchcwvenwgiy
    dpadpdglphaneymhdflesrskwaaqlnkpivmeafgmardawrnpedetykylpstp
    tshkdeyyqkafnqivslasnrsfsgsnfwayggegrstyppnpygmvwlgdpphephgw
    ysvysndttvqiikdynanllkvqkelsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lyrA (A:)
    fafvkiasdgkgftrygepylirganywqgmnlgaddcsggdrkrmeleikqmaemginn
    lrvmassegpddqpyrmrpsmmpqpgkynegvfvgldylldtmdrynmtavmtlgnfwqw
    sggfgqyvawitgnqtipypvgdvtydeftqfaarfyndseiapkanklfkdhiytvqnr
    rntvngkiykedpvimswqianepqeapaswfeeistfikkgapkhlvsagleskldeyd
    fdrahdhknidyttchcwvenwgiydpadpdglphaneymhdflesrskwaaqlnkpivm
    eafgmardawrnpedetykylpstptshkdeyyqkafnqivslasnrsfsgsnfwaygge
    grstyppnpygmvwlgdpphephgwysvysndttvqiikdynanllkvqkelsk