PDB entry 4lye

View 4lye on RCSB PDB site
Description: Crystal structure of the S105A mutant of a C-C hydrolase, DxnB2 from Sphingomonas wittichii RW1, in complex with substrate HOPDA
Class: hydrolase
Keywords: meta-cleavage product hydrolase, C-C bond hydrolase, alpha-beta hydrolase, dibenzo-p-dioxin degradation, dibenzofuran degradation, HYDROLASE
Deposited on 2013-07-31, released 2013-10-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: 0.187
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MCP Hydrolase
    Species: SPHINGOMONAS WITTICHII [TaxId:392499]
    Gene: dxnB2, Swit_3055
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5VAT9 (0-End)
      • engineered mutation (104)
    Domains in SCOPe 2.05: d4lyea_
  • Heterogens: HPK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lyeA (A:)
    mfeqfeskfidcdgirthyiemgegdplvlvhgggagadgrsnfadnfpifarhmrviay
    dmvgfgqtdapdpagfaytqaartdhlisfikalglskiclignamggttacgaalkape
    lidrlvlmgaavnispddmvanrddlaavmsydgseegmrkiiaalthsyqptddivhyr
    heaslrptttaaykatmgwakqnglyyspeqlasltmpvlvlggkndvmvpvrkvidqil
    aipqaighvfpncghwvmieypeefctqtlhffgkld
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lyeA (A:)
    mfeqfeskfidcdgirthyiemgegdplvlvhgggagadgrsnfadnfpifarhmrviay
    dmvgfgqtdapdpagfaytqaartdhlisfikalglskiclignamggttacgaalkape
    lidrlvlmgaavnispddmvanrddlaavmsydgseegmrkiiaalthsyqptddivhyr
    heaslrptttaaykatmgwakqnglyyspeqlasltmpvlvlggkndvmvpvrkvidqil
    aipqaighvfpncghwvmieypeefctqtlhffgkl