PDB entry 4lxh

View 4lxh on RCSB PDB site
Description: Crystal Structure of the S105A mutant of a carbon-carbon bond hydrolase, DxnB2 from Sphingomonas wittichii RW1, in complex with 3-Cl HOPDA
Class: hydrolase
Keywords: carbon-carbon bond hydrolase, Rossmann Fold, alpha/beta hydrolase fold, cytosolic, HYDROLASE
Deposited on 2013-07-29, released 2013-09-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.217
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MCP Hydrolase
    Species: Sphingomonas wittichii RW1 [TaxId:392499]
    Gene: dxnB2, Swit_3055
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5VAT9 (0-End)
      • engineered mutation (104)
    Domains in SCOPe 2.05: d4lxha_
  • Heterogens: C1E, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lxhA (A:)
    mfeqfeskfidcdgirthyiemgegdplvlvhgggagadgrsnfadnfpifarhmrviay
    dmvgfgqtdapdpagfaytqaartdhlisfikalglskiclignamggttacgaalkape
    lidrlvlmgaavnispddmvanrddlaavmsydgseegmrkiiaalthsyqptddivhyr
    heaslrptttaaykatmgwakqnglyyspeqlasltmpvlvlggkndvmvpvrkvidqil
    aipqaighvfpncghwvmieypeefctqtlhffgkld
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lxhA (A:)
    mfeqfeskfidcdgirthyiemgegdplvlvhgggagadgrsnfadnfpifarhmrviay
    dmvgfgqtdapdpagfaytqaartdhlisfikalglskiclignamggttacgaalkape
    lidrlvlmgaavnispddmvanrddlaavmsydgseegmrkiiaalthsyqptddivhyr
    heaslrptttaaykatmgwakqnglyyspeqlasltmpvlvlggkndvmvpvrkvidqil
    aipqaighvfpncghwvmieypeefctqtlhffgkl