PDB entry 4lxg

View 4lxg on RCSB PDB site
Description: Crystal structure of DxnB2, a carbon - carbon bond hydrolase from Sphingomonas wittichii RW1
Class: hydrolase
Keywords: Carbon-carbon bond hydrolase, Rossmann Fold, alpha/beta hydrolase fold, Cytosolic, HYDROLASE
Deposited on 2013-07-29, released 2013-09-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: 0.203
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MCP Hydrolase
    Species: Sphingomonas wittichii RW1 [TaxId:392499]
    Gene: dxnB2, Swit_3055
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4lxga_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lxgA (A:)
    mfeqfeskfidcdgirthyiemgegdplvlvhgggagadgrsnfadnfpifarhmrviay
    dmvgfgqtdapdpagfaytqaartdhlisfikalglskiclignsmggttacgaalkape
    lidrlvlmgaavnispddmvanrddlaavmsydgseegmrkiiaalthsyqptddivhyr
    heaslrptttaaykatmgwakqnglyyspeqlasltmpvlvlggkndvmvpvrkvidqil
    aipqaighvfpncghwvmieypeefctqtlhffgkld
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lxgA (A:)
    mfeqfeskfidcdgirthyiemgegdplvlvhgggagadgrsnfadnfpifarhmrviay
    dmvgfgqtdapdpagfaytqaartdhlisfikalglskiclignsmggttacgaalkape
    lidrlvlmgaavnispddmvaddlaavmsydgseegmrkiiaalthsyqptddivhyrhe
    aslrptttaaykatmgwakqnglyyspeqlasltmpvlvlggkndvmvpvrkvidqilai
    pqaighvfpncghwvmieypeefctqtlhffgkl