PDB entry 4lx4

View 4lx4 on RCSB PDB site
Description: Crystal Structure Determination of Pseudomonas stutzeri endoglucanase Cel5A using a Twinned Data Set
Class: hydrolase
Keywords: glycosyl hydrolase family 5, cellulase, tim barrel, beta-1,4-endoglucanase, hydrolase
Deposited on 2013-07-29, released 2014-07-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-07-30, with a file datestamp of 2014-07-25.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.224
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoglucanase(Endo-1,4-beta-glucanase)protein
    Species: Pseudomonas stutzeri [TaxId:379731]
    Gene: PST_2494
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lx4a_
  • Chain 'B':
    Compound: Endoglucanase(Endo-1,4-beta-glucanase)protein
    Species: Pseudomonas stutzeri [TaxId:379731]
    Gene: PST_2494
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lx4b_
  • Chain 'C':
    Compound: Endoglucanase(Endo-1,4-beta-glucanase)protein
    Species: Pseudomonas stutzeri [TaxId:379731]
    Gene: PST_2494
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lx4c_
  • Chain 'D':
    Compound: Endoglucanase(Endo-1,4-beta-glucanase)protein
    Species: Pseudomonas stutzeri [TaxId:379731]
    Gene: PST_2494
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lx4d_
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lx4A (A:)
    adwpvndegglalhgvnisgagfaphitpgkngthyfypekkhfkyyadqgirlirfpfi
    wervqhsldsglnfdqirllkktldlaaqngqkvildmhnygryhgeligsskvpyeaya
    svwrklaerfkghpgllgydimnephstvglwpgaaqaavdairevddqtlifiegerws
    sayhwplvnanflindpadrliyeahlyfdddfsgkymaqtsrnidpmigverarpfiew
    lqkhgqkgflgeygipddlpeaaqamdnllaylndncvpsaywaggpgwgtyklaieprn
    gkdrpqmelmrkhlandctaigptpaqiad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lx4A (A:)
    dwpvndegglalhgvnisgagfaphitpgkngthyfypekkhfkyyadqgirlirfpfiw
    ervqhsldsglnfdqirllkktldlaaqngqkvildmhnygryhgeligsskvpyeayas
    vwrklaerfkghpgllgydimnephstvglwpgaaqaavdairevddqtlifiegerwss
    ayhwplvnanflindpadrliyeahlyfdddfsgkymaqtsrnidpmigverarpfiewl
    qkhgqkgflgeygipddlpeaaqamdnllaylndncvpsaywaggpgwgtyklaieprng
    kdrpqmelmrkhlandctaigp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lx4B (B:)
    adwpvndegglalhgvnisgagfaphitpgkngthyfypekkhfkyyadqgirlirfpfi
    wervqhsldsglnfdqirllkktldlaaqngqkvildmhnygryhgeligsskvpyeaya
    svwrklaerfkghpgllgydimnephstvglwpgaaqaavdairevddqtlifiegerws
    sayhwplvnanflindpadrliyeahlyfdddfsgkymaqtsrnidpmigverarpfiew
    lqkhgqkgflgeygipddlpeaaqamdnllaylndncvpsaywaggpgwgtyklaieprn
    gkdrpqmelmrkhlandctaigptpaqiad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lx4B (B:)
    wpvndegglalhgvnisgagfaphitpgkngthyfypekkhfkyyadqgirlirfpfiwe
    rvqhsldsglnfdqirllkktldlaaqngqkvildmhnygryhgeligsskvpyeayasv
    wrklaerfkghpgllgydimnephstvglwpgaaqaavdairevddqtlifiegerwssa
    yhwplvnanflindpadrliyeahlyfdddfsgkymaqtsrnidpmigverarpfiewlq
    khgqkgflgeygipddlpeaaqamdnllaylndncvpsaywaggpgwgtyklaieprngk
    drpqmelmrkhlandctaigptpaqiad
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4lx4C (C:)
    adwpvndegglalhgvnisgagfaphitpgkngthyfypekkhfkyyadqgirlirfpfi
    wervqhsldsglnfdqirllkktldlaaqngqkvildmhnygryhgeligsskvpyeaya
    svwrklaerfkghpgllgydimnephstvglwpgaaqaavdairevddqtlifiegerws
    sayhwplvnanflindpadrliyeahlyfdddfsgkymaqtsrnidpmigverarpfiew
    lqkhgqkgflgeygipddlpeaaqamdnllaylndncvpsaywaggpgwgtyklaieprn
    gkdrpqmelmrkhlandctaigptpaqiad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lx4C (C:)
    wpvndegglalhgvnisgagfaphitpgkngthyfypekkhfkyyadqgirlirfpfiwe
    rvqhsldsglnfdqirllkktldlaaqngqkvildmhnygryhgeligsskvpyeayasv
    wrklaerfkghpgllgydimnephstvglwpgaaqaavdairevddqtlifiegerwssa
    yhwplvnanflindpadrliyeahlyfdddfsgkymaqtsrnidpmigverarpfiewlq
    khgqkgflgeygipddlpeaaqamdnllaylndncvpsaywaggpgwgtyklaieprkdr
    pqmelmrkhlandctaigptp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4lx4D (D:)
    adwpvndegglalhgvnisgagfaphitpgkngthyfypekkhfkyyadqgirlirfpfi
    wervqhsldsglnfdqirllkktldlaaqngqkvildmhnygryhgeligsskvpyeaya
    svwrklaerfkghpgllgydimnephstvglwpgaaqaavdairevddqtlifiegerws
    sayhwplvnanflindpadrliyeahlyfdddfsgkymaqtsrnidpmigverarpfiew
    lqkhgqkgflgeygipddlpeaaqamdnllaylndncvpsaywaggpgwgtyklaieprn
    gkdrpqmelmrkhlandctaigptpaqiad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lx4D (D:)
    dwpvndegglalhgvnisgagfaphitpgkngthyfypekkhfkyyadqgirlirfpfiw
    ervqhsldsglnfdqirllkktldlaaqngqkvildmhnygryhgeligsskvpyeayas
    vwrklaerfkghpgllgydimnephstvglwpgaaqaavdairevddqtlifiegerwss
    ayhwplvnanflindpadrliyeahlyfdddfsgkymaqtsrnidpmigverarpfiewl
    qkhgqkgflgeygipddlpeaaqamdnllaylndncvpsaywaggpgwgtyklaiepdrp
    qmelmrkhlandctaigpt