PDB entry 4lx0

View 4lx0 on RCSB PDB site
Description: Crystal structure of Myo5b globular tail domain in complex with active Rab11a
Class: protein transport/contractile protein
Keywords: DIL, PROTEIN TRANSPORT-CONTRACTILE PROTEIN complex
Deposited on 2013-07-29, released 2013-11-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.183
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB11A, RAB11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4lx0a_
  • Chain 'B':
    Compound: Unconventional myosin-Vb
    Species: Homo sapiens [TaxId:9606]
    Gene: MYO5B, KIAA1119
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ULV0 (34-426)
      • expression tag (24-29)
      • expression tag (29)
      • expression tag (29)
      • expression tag (29)
      • expression tag (33)
      • expression tag (24-27)
  • Chain 'C':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB11A, RAB11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4lx0c_
  • Chain 'D':
    Compound: Unconventional myosin-Vb
    Species: Homo sapiens [TaxId:9606]
    Gene: MYO5B, KIAA1119
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ULV0 (34-426)
      • expression tag (23-28)
      • expression tag (33)
      • expression tag (23-28)
      • expression tag (32)
  • Heterogens: MG, BEF, GDP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lx0A (A:)
    mgtrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgkti
    kaqiwdtagqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivim
    lvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lx0A (A:)
    eydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
    tagqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnks
    dlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivs
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4lx0C (C:)
    mgtrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgkti
    kaqiwdtagqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivim
    lvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lx0C (C:)
    eydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
    tagqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnks
    dlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivs
    

  • Chain 'D':
    No sequence available.