PDB entry 4lwy

View 4lwy on RCSB PDB site
Description: L(M196)H,H(M202)L Double Mutant Structure of Photosynthetic Reaction Center From Rhodobacter Sphaeroides strain RV
Class: electron transport, membrane protein
Keywords: Photosynthetic reaction center, Primary electron donor, photon, membrane, electron transport, membrane protein
Deposited on 2013-07-29, released 2014-07-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.216
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: reaction center protein h chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: puhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lwyh1, d4lwyh2
  • Chain 'L':
    Compound: reaction center protein l chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: pufL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C0Y8 (Start-281)
      • see remark 999 (178)
    Domains in SCOPe 2.07: d4lwyl_
  • Chain 'M':
    Compound: reaction center protein m chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: pufM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C0Y9 (Start-302)
      • see remark 999 (8)
      • engineered mutation (196)
      • engineered mutation (202)
    Domains in SCOPe 2.07: d4lwym_
  • Heterogens: LDA, UNL, PO4, DIO, EDO, TRS, K, BCL, BPH, U10, CDL, FE, SPN, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4lwyH (H:)
    mvgvtafgnfdlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpk
    pktfilphgrgtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdl
    peldghghnkikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarfle
    velkdgstrllpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagg
    lmyaapkrksvvaamlaeya
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lwyH (H:)
    dlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpkpktfilphgr
    gtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdlpeldghghnk
    ikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarflevelkdgstrl
    lpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagglmyaapkrks
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4lwyL (L:)
    mallsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtw
    npqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipf
    afafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaitf
    fftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllsls
    avffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lwyL (L:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaitff
    ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
    vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4lwyM (M:)
    maeyqniftqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvls
    lfsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwlias
    ffmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygi
    fshldwtnnfslvhgnhfynpflglsiaflygsallfamhgatilavsrfggereleqia
    drgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgq
    nhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lwyM (M:)
    aeyqniftqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
    fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
    fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
    shldwtnnfslvhgnhfynpflglsiaflygsallfamhgatilavsrfggereleqiad
    rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
    hg