PDB entry 4lwq

View 4lwq on RCSB PDB site
Description: Crystal structure of native peptidyl t-RNA hydrolase from Acinetobacter baumannii at 1.38A resolution
Class: Hydrolase
Keywords: Protein synthesis, Hydrolase
Deposited on 2013-07-28, released 2013-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: 0.131
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptidyl-tRNA hydrolase
  Species: Acinetobacter baumannii [TaxId:575584]
  Gene: PTH
  Database cross-references and differences (RAF-indexed):
  • Uniprot D0C9L6 (3-195)
    • expression tag (0-2)
  Domains in SCOPe 2.07: d4lwqa1, d4lwqa2
• Heterogens: GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4lwqA (A:)
  gshmsnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieg
  hdvrlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghng
  lrdivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvq
  gqvpqamnqinaykpa