PDB entry 4lve

View 4lve on RCSB PDB site
Description: len k30t mutant: a domain flip as a result of a single amino acid substitution
Deposited on 1998-05-12, released 1999-05-18
The last revision prior to the SCOP 1.55 freeze date was dated 1999-05-18, with a file datestamp of 1999-05-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d4lvea_
  • Chain 'B':
    Domains in SCOP 1.55: d4lveb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lveA (A:)
    divmtqspdslavslgeratinckssqsvlyssnstnylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleikr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lveB (B:)
    divmtqspdslavslgeratinckssqsvlyssnstnylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpysfgqgtkleik