PDB entry 4lv8

View 4lv8 on RCSB PDB site
Description: Murine IRGa6 bound to Toxoplasma ROP5C, a pseudokinase GDI
Class: Transferase/Hydrolase
Keywords: immune related GTPase, guanine dissociation inhibitor, parasite effector, Transferase-Hydrolase complex
Deposited on 2013-07-26, released 2013-09-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-10-02, with a file datestamp of 2013-09-27.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.196
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rhoptry protein 5 C
    Species: Toxoplasma gondii type I [TaxId:1209525]
    Gene: ROP5C
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Interferon-inducible GTPase 1
    Species: Mus musculus [TaxId:10090]
    Gene: Iigp1, Irga6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4lv8b_
  • Heterogens: ADP, MG, EDO, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lv8B (B:)
    gspgipgsttmgqlfsspksdenndlpssftgyfkkfntgrkiisqeilnlielrmrkgn
    iqltnsaisdalkeidssvlnvavtgetgsgkssfintlrgigneeegaaktgvvevtme
    rhpykhpnipnvvfwdlpgigstnfppntylekmkfyeydffiiisatrfkkndidiaka
    ismmkkefyfvrtkvdsditneadgkpqtfdkekvlqdirlncvntfrengiaeppifll
    snknvchydfpvlmdklisdlpiykrhnfmvslpnitdsviekkrqflkqriwlegfaad
    lvniipsltflldsdletlkksmkfyrtvfgvdetslqrlardweievdqveamikspav
    fkptdeetiqerlsryiqefclangyllpknsflkeifylkyyfldmvtedaktllkeic
    lrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lv8B (B:)
    ndlpssftgyfkkfntgrkiisqeilnlielrmrkgniqltnsaisdalkeidssvlnva
    vtgetgsgkssfintlrgigneeegaaktgvvevtmerhpykhpnipnvvfwdlpgigst
    nfppntylekmkfyeydffiiisatrfkkndidiakaismmkkefyfvrtkvdsditnea
    dgkpqtfdkekvlqdirlncvntfrengiaeppifllsnknvchydfpvlmdklisdlpi
    ykrhnfmvslpnitdsviekkrqflkqriwlegfaadlvniipsltflldsdletlkksm
    kfyrtvfgvdetslqrlvdqveamikspavfkptdeetiqerlsryiqefclangyllpk
    nsflkeifylkyyfldmvtedaktllkeic