PDB entry 4luz

View 4luz on RCSB PDB site
Description: Fragment-Based Discovery of a Potent Inhibitor of Replication Protein A Protein-Protein Interactions
Class: DNA BINDING protein/inhibitor
Keywords: OB-FOLD, PROTEIN-PROTEIN INTERACTION, DNA BINDING protein-inhibitor complex
Deposited on 2013-07-25, released 2013-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.181
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replication protein A 70 kDa DNA-binding subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: RPA1, REPA1, RPA70
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27694 (3-122)
      • expression tag (0-2)
      • engineered mutation (9)
    Domains in SCOPe 2.08: d4luza1, d4luza2
  • Heterogens: 1XT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4luzA (A:)
gshmvgqlsrgaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfm
latqlnplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkignpvp
yne