PDB entry 4lud

View 4lud on RCSB PDB site
Description: Crystal Structure of HCK in complex with the fluorescent compound SKF86002
Class: transferase/transferase inhibitor
Keywords: cocrystallization, SKF86002, fluorescence, inhibitor screening, kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-07-25, released 2014-02-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.215
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase HCK
    Species: Homo sapiens [TaxId:9606]
    Gene: HCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08631 (8-453)
      • expression tag (7)
      • engineered mutation (450-452)
    Domains in SCOPe 2.05: d4luda1, d4luda2, d4luda3
  • Chain 'B':
    Compound: Tyrosine-protein kinase HCK
    Species: Homo sapiens [TaxId:9606]
    Gene: HCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08631 (8-End)
      • expression tag (7)
      • engineered mutation (450-451)
    Domains in SCOPe 2.05: d4ludb1, d4ludb2, d4ludb3
  • Heterogens: CA, SK8, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ludA (A:)
    gamgsgiriivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsny
    varvdsleteewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqg
    dtvkhykirtldnggfyisprstfstlqelvdhykkgndglcqklsvpcmsskpqkpwek
    daweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveaflaeanvmktl
    qhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaqiaegmafi
    eqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwtapeainfg
    sftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmr
    cwknrpeerptfeyiqsvlddfytatesqyeeip
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ludA (A:)
    riivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarlete
    ewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykirt
    ldgfyisprstfstlqelvdhykkgndglcqklsvpcmsskpqkpwekdaweipreslkl
    ekklgagqfgevwmatynkhtkvavktmkpsveaflaeanvmktlqhdklvklhavvtke
    piyiitefmakgslldflksdegskqplpklidfsaqiaegmafieqrnyihrdlraani
    lvsaslvckiadfglarvipikwtapeainfgsftiksdvwsfgillmeivtygripypg
    msnpelergyrmprpencpeelynimmrcwknrpeerptfeyiqsvlddfytatesqyee
    ip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ludB (B:)
    gamgsgiriivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsny
    varvdsleteewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqg
    dtvkhykirtldnggfyisprstfstlqelvdhykkgndglcqklsvpcmsskpqkpwek
    daweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveaflaeanvmktl
    qhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaqiaegmafi
    eqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwtapeainfg
    sftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmr
    cwknrpeerptfeyiqsvlddfytatesqyeeip
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ludB (B:)
    riivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsl
    eteewffkgisrkdaerqllapgnmlgsfmirdsetsyslsvrdydprqgdtvkhykitl
    qelvdhykkgndglcqklsvpcmsskpqkpwekdaweipreslklekklgagqfgevwma
    tynkhtkvavktmkpgsveaflaeanvmktlqhdklvklhavvtkepiyiitefmakgsl
    ldflksdegskqplpklidfsaqiaegmafieqrnyihrdlraanilvsaslvckiadfg
    larvipikwtapeainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergy
    rmprpencpeelynimmrcwknrpeerptfeyiqsvlddfytatesqyee