PDB entry 4lu5

View 4lu5 on RCSB PDB site
Description: Structure of murine IgG2a A20G2-Fab in complex with vaccinia antigen A33R at the resolution of 2.9 Angstroms
Class: immune system
Keywords: IgG domain, antibody-antigen complex, Fv, CH1, IgG2a, antigen-binding fragment (Fab), A33R antigen, Papain digest of the mAb, EEV membrane (outer membrane of vaccinia EV form), IMMUNE SYSTEM
Deposited on 2013-07-24, released 2014-07-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: a33r
    Species: Vaccinia virus [TaxId:10245]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q71TT1 (Start-96)
      • engineered mutation (29)
      • engineered mutation (34)
      • engineered mutation (51)
  • Chain 'B':
    Compound: a33r
    Species: Vaccinia virus [TaxId:10245]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q71TT1 (Start-96)
      • engineered mutation (29)
      • engineered mutation (34)
      • engineered mutation (51)
  • Chain 'H':
    Compound: Murine IgG2a A20G2 Heavy chain Fab domain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LU5 (0-212)
  • Chain 'I':
    Compound: Murine IgG2a A20G2 Heavy chain Fab domain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LU5 (0-212)
  • Chain 'L':
    Compound: Murine IgG2a A20G2 Light chain Fab domain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LU5 (0-218)
    Domains in SCOPe 2.07: d4lu5l1, d4lu5l2
  • Chain 'M':
    Compound: Murine IgG2a A20G2 Light chain Fab domain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LU5 (0-218)
    Domains in SCOPe 2.07: d4lu5m1, d4lu5m2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lu5L (L:)
    dvvmtqtpltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrliylvskld
    sgvpdrftgsgsgtdftlkisrveaedlgiyycvqgthfpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lu5M (M:)
    dvvmtqtpltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrliylvskld
    sgvpdrftgsgsgtdftlkisrveaedlgiyycvqgthfpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec