PDB entry 4ltw

View 4ltw on RCSB PDB site
Description: Ancestral Ketosteroid Receptor-Progesterone-Mifepristone Complex
Class: hormone receptor
Keywords: Nuclear Receptor, Steroid Receptor, HORMONE RECEPTOR
Deposited on 2013-07-24, released 2013-12-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.182
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ancestral Steroid Receptor 2
    Species: Ancestral Gene
    Database cross-references and differences (RAF-indexed):
    • PDB 4LTW (0-End)
    Domains in SCOPe 2.06: d4ltwa_
  • Heterogens: STR, 486, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ltwA (A:)
    snapslisilqaiepevvyagydntqpdttnyllsslnrlaekqlvsvvkwakalpgfrn
    lhlddqmtliqyswmglmafamgwrsykhtngqmlyfapdlifneqrmqqsamydlcqgm
    qqisqefvrlqvtqeeflcmkallllstvpkeglksqasfdemrmnyikelnraiakken
    nsaqnwqrfyqltklldsmhdlvggllqfcfytfvqsqalsvefpemlveiisaqlpkvl
    agmakpllfhkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ltwA (A:)
    snapslisilqaiepevvyagydntqpdttnyllsslnrlaekqlvsvvkwakalpgfrn
    lhlddqmtliqyswmglmafamgwrsykhtngqmlyfapdlifneqrmqqsamydlcqgm
    qqisqefvrlqvtqeeflcmkallllstvpkeglksqasfdemrmnyikelnraiakken
    nsaqnwqrfyqltklldsmhdlvggllqfcfytfvqsqalsvefpemlveiisaqlpkvl
    agmakpllfhk