PDB entry 4ltv

View 4ltv on RCSB PDB site
Description: Crystal structure of epi-isozizaene synthase from Streptomyces coelicolor A3(2)
Class: lyase
Keywords: LYASE, Class I terpene cyclase
Deposited on 2013-07-24, released 2013-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.197
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epi-isozizaene synthase
    Species: STREPTOMYCES COELICOLOR [TaxId:100226]
    Gene: cyc1, SCO5222, SC7E4.19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ltva_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ltvA (A:)
    mgsshhhhhhssglvprgshmvhafphgttatptaiavppslrlpvieaafprqlhpywp
    klqettrtwllekrlmpadkveeyadglcytdlmagyylgapdevlqaiadysawffvwd
    drhdrdivhgragawrrlrgllhtaldspgdhlhhedtlvagfadsvrrlyaflpatwna
    rfarhfhtvieaydrefhnrtrgivpgveeylelrrltfahwiwtdllepssgcelpdav
    rkhpayrraallsqefaawyndlcslpkeiagdevhnlgislithhsltleeaigevrrr
    veeciteflaverdalrfadeladgtvrgkelsgavranvgnmrnwfssvywfhhesgry
    mvdswddrstppyvnneaagek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ltvA (A:)
    vppslrlpvieaafprqlhpywpklqettrtwllekrlmpadkveeyadglcytdlmagy
    ylgapdevlqaiadysawffvwddrhdrdivhgragawrrlrgllhtaldspgdhlhhed
    tlvagfadsvrrlyaflpatwnarfarhfhtvieaydrefhnrtrgivpgveeylelrrl
    tfahwiwtdllepssgcelpdavrkhpayrraallsqefaawyndlcslpkevhnlgisl
    ithhsltleeaigevrrrveeciteflaverdalrfadeladgtvrgkelsgavranvgn
    mrnwfssvywfhhe