PDB entry 4lsv

View 4lsv on RCSB PDB site
Description: Crystal structure of broadly and potently neutralizing antibody 3BNC117 in complex with HIV-1 clade C C1086 gp120
Class: viral protein/immune system
Keywords: Neutralizing antibody 3BNC117, viral protein-immune system complex
Deposited on 2013-07-23, released 2013-08-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-05-07, with a file datestamp of 2014-05-02.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.262
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: envelope glycoprotein gp120
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
    • PDB 4LSV (0-357)
  • Chain 'H':
    Compound: heavy chain of antibody 3bnc117
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LSV (0-End)
  • Chain 'L':
    Compound: light chain of antibody 3bnc117
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LSV (0-End)
    Domains in SCOPe 2.05: d4lsvl1, d4lsvl2
  • Heterogens: NAG, IMD, HOH

PDB Chain Sequences:

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download) 
    >4lsvL (L:)
diqmtqspsslsasvgdtvtitcqangylnwyqqrrgkapklliydgsklergvpsrfsg
rrwgqeynltinnlqpediatyfcqvyefvvpgtrldlkrtvaapsvfifppsdeqlksg
tasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskadyek
hkvyacevthqglsspvtksfnrgec

    Sequence, based on observed residues (ATOM records): (download) 
    >4lsvL (L:)
diqmtqspsslsasvgdtvtitcqangylnwyqqrrgkapklliydgsklergvpsrfsg
rrwgqeynltinnlqpediatyfcqvyefvvpgtrldlkrtvaapsvfifppsdeqlksg
tasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskadyek
hkvyacevthqglsspvtksfnr