PDB entry 4lsr

View 4lsr on RCSB PDB site
Description: Crystal structure of broadly and potently neutralizing antibody VRC-CH31 in complex with HIV-1 clade A/E stran 93TH057 gp120 with LOOP D and Loop V5 from clade A strain KER_2018_11
Class: viral protein/immune system
Keywords: Neutralizing antibody VRC-CH31, viral protein-immune system complex
Deposited on 2013-07-23, released 2013-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-05-07, with a file datestamp of 2014-05-02.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.198
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: ENVELOPE GLYCOPROTEIN GP120 WITH LOOP D AND V5 FROM STRAIN ker_2018_11
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
    • PDB 4LSR (0-End)
  • Chain 'H':
    Compound: heavy chain of antibody vrc-ch31
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LSR (0-End)
  • Chain 'L':
    Compound: light chain of antibody vrc-ch31 (n70d mutation)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LSR (0-End)
    Domains in SCOPe 2.07: d4lsrl1, d4lsrl2
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4lsrL (L:)
    diqmtqspsslsaslgdrvtitcqasrgigkdlnwyqqkagkapkllvsdastleggvps
    rfsgsgfhqdfsltisslqaedvatyfcqqyetfgqgtkvdikrtvaapsvfifppsdeq
    lksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlska
    dyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lsrL (L:)
    diqmtqspsslsaslgdrvtitcqasrgigkdlnwyqqkagkapkllvsdastleggvps
    rfsgsgfhqdfsltisslqaedvatyfcqqyetfgqgtkvdikrtvaapsvfifppsdeq
    lksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlska
    dyekhkvyacevthqglsspvtksfnrg