PDB entry 4lsp

View 4lsp on RCSB PDB site
Description: Crystal structure of broadly and potently neutralizing antibody VRC-CH31 in complex with HIV-1 clade A/E gp120 93TH057
Class: viral protein/immune system
Keywords: Neutralizing antibody VRC-CH31, HIV envelope glycoprotein gp120, viral protein-immune system complex
Deposited on 2013-07-23, released 2013-09-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-02, with a file datestamp of 2021-05-28.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: hiv-1 clade a/e strain 93th057 gp120
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
    • PDB 4LSP (0-352)
  • Chain 'H':
    Compound: heavy chain of antibody vrc-ch31
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LSP (0-End)
  • Chain 'L':
    Compound: light chain of antibody vrc-ch31
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LSP (0-End)
    Domains in SCOPe 2.08: d4lspl1, d4lspl2
  • Heterogens: NAG, SO4, EDO, PEG, NA, HOH

PDB Chain Sequences:

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4lspL (L:)
    diqmtqspsslsaslgdrvtitcqasrgigkdlnwyqqkagkapkllvsdastleggvps
    rfsgsgfhqnfsltisslqaedvatyfcqqyetfgqgtkvdikrtvaapsvfifppsdeq
    lksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlska
    dyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lspL (L:)
    diqmtqspsslsaslgdrvtitcqasrgigkdlnwyqqkagkapkllvsdastleggvps
    rfsgsgfhqnfsltisslqaedvatyfcqqyetfgqgtkvdikrtvaapsvfifppsdeq
    lksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlska
    dyekhkvyacevthqglsspvtksfnrg