PDB entry 4ls7

View 4ls7 on RCSB PDB site
Description: Crystal structure of Bacillus subtilis beta-ketoacyl-ACP synthase II (FabF) in a non-covalent complex with cerulenin
Class: transferase/transferase inhibitor
Keywords: KASII, CONDENSING ENZYME, FATTY ACID ELONGATION, DRUG TARGET, transferase-transferase inhibitor complex
Deposited on 2013-07-22, released 2014-04-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-06-04, with a file datestamp of 2014-05-30.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.151
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 2
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: fabF, yjaY, BSU11340
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ls7a1, d4ls7a2
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 2
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: fabF, yjaY, BSU11340
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34340 (13-End)
      • expression tag (11-12)
    Domains in SCOPe 2.06: d4ls7b1, d4ls7b2, d4ls7b3
  • Heterogens: K, GOL, 1X9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ls7A (A:)
    mrgshhhhhhgiqmtkkrvvvtglgalsplgndvdtswnnaingvsgigpitrvdaeeyp
    akvaaelkdfnvedymdkkearkmdrftqyavvaakmavedadlnitdeiaprvgvwvgs
    giggletlesqfeifltkgprrvspffvpmmipdmatgqisialgakgvnsctvtacatg
    tnsigdafkviqrgdadvmvtggteapltrmsfagfsankalstnpdpktasrpfdknrd
    gfvmgegagiivleelehalargakiygeivgygstgdayhitapaqdgeggaramqeai
    kdagiapeeidyinahgtstyyndkyetmaiktvfgehahklavsstksmtghllgaagg
    ieaifsilaikegvipptiniqtpdeecdldyvpdearrqelnyvlsnslgfgghnatli
    fkkyqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ls7A (A:)
    mtkkrvvvtglgalsplgndvdtswnnaingvsgigpitrvdaeeypakvaaelkdfnve
    dymdkkearkmdrftqyavvaakmavedadlnitdeiaprvgvwvgsgiggletlesqfe
    ifltkgprrvspffvpmmipdmatgqisialgakgvnsctvtacatgtnsigdafkviqr
    gdadvmvtggteapltrmsfagfsankalstnpdpktasrpfdknrdgfvmgegagiivl
    eelehalargakiygeivgygstgdayhitapaqdgeggaramqeaikdagiapeeidyi
    nahgtstyyndkyetmaiktvfgehahklavsstksmtghllgaaggieaifsilaikeg
    vipptiniqtpdeecdldyvpdearrqelnyvlsnslgfgghnatlifkkyqs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ls7B (B:)
    mrgshhhhhhgiqmtkkrvvvtglgalsplgndvdtswnnaingvsgigpitrvdaeeyp
    akvaaelkdfnvedymdkkearkmdrftqyavvaakmavedadlnitdeiaprvgvwvgs
    giggletlesqfeifltkgprrvspffvpmmipdmatgqisialgakgvnsctvtacatg
    tnsigdafkviqrgdadvmvtggteapltrmsfagfsankalstnpdpktasrpfdknrd
    gfvmgegagiivleelehalargakiygeivgygstgdayhitapaqdgeggaramqeai
    kdagiapeeidyinahgtstyyndkyetmaiktvfgehahklavsstksmtghllgaagg
    ieaifsilaikegvipptiniqtpdeecdldyvpdearrqelnyvlsnslgfgghnatli
    fkkyqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ls7B (B:)
    iqmtkkrvvvtglgalsplgndvdtswnnaingvsgigpitrvdaeeypakvaaelkdfn
    vedymdkkearkmdrftqyavvaakmavedadlnitdeiaprvgvwvgsgiggletlesq
    feifltkgprrvspffvpmmipdmatgqisialgakgvnsctvtacatgtnsigdafkvi
    qrgdadvmvtggteapltrmsfagfsankalstnpdpktasrpfdknrdgfvmgegagii
    vleelehalargakiygeivgygstgdayhitapaqdgeggaramqeaikdagiapeeid
    yinahgtstyyndkyetmaiktvfgehahklavsstksmtghllgaaggieaifsilaik
    egvipptiniqtpdeecdldyvpdearrqelnyvlsnslgfgghnatlifkkyq