PDB entry 4ls6

View 4ls6 on RCSB PDB site
Description: Crystal structure of beta-ketoacyl-ACP synthase II (FabF) I108F mutant from Bacillus subtilis
Class: Transferase
Keywords: KASII, KETOACYL SYNTHASE, FATTY ACID ELONGATION, CERULENIN RESISTANT, Transferase
Deposited on 2013-07-22, released 2014-04-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-06-04, with a file datestamp of 2014-05-30.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.149
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 2
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: fabF, yjaY, BSU11340
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34340 (Start-425)
      • engineered mutation (121)
    Domains in SCOPe 2.06: d4ls6a1, d4ls6a2
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 2
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: fabF, yjaY, BSU11340
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34340
      • engineered mutation (121)
    Domains in SCOPe 2.06: d4ls6b1, d4ls6b2
  • Heterogens: K, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ls6A (A:)
    mrgshhhhhhgiqmtkkrvvvtglgalsplgndvdtswnnaingvsgigpitrvdaeeyp
    akvaaelkdfnvedymdkkearkmdrftqyavvaakmavedadlnitdeiaprvgvwvgs
    gfggletlesqfeifltkgprrvspffvpmmipdmatgqisialgakgvnsctvtacatg
    tnsigdafkviqrgdadvmvtggteapltrmsfagfsankalstnpdpktasrpfdknrd
    gfvmgegagiivleelehalargakiygeivgygstgdayhitapaqdgeggaramqeai
    kdagiapeeidyinahgtstyyndkyetmaiktvfgehahklavsstksmtghllgaagg
    ieaifsilaikegvipptiniqtpdeecdldyvpdearrqelnyvlsnslgfgghnatli
    fkkyqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ls6A (A:)
    kkrvvvtglgalsplgndvdtswnnaingvsgigpitrvdaeeypakvaaelkdfnvedy
    mdkkearkmdrftqyavvaakmavedadlnitdeiaprvgvwvgsgfggletlesqfeif
    ltkgprrvspffvpmmipdmatgqisialgakgvnsctvtacatgtnsigdafkviqrgd
    advmvtggteapltrmsfagfsankalstnpdpktasrpfdknrdgfvmgegagiivlee
    lehalargakiygeivgygstgdayhitapaqdgeggaramqeaikdagiapeeidyina
    hgtstyyndkyetmaiktvfgehahklavsstksmtghllgaaggieaifsilaikegvi
    pptiniqtpdeecdldyvpdearrqelnyvlsnslgfgghnatlifkkyqs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ls6B (B:)
    mrgshhhhhhgiqmtkkrvvvtglgalsplgndvdtswnnaingvsgigpitrvdaeeyp
    akvaaelkdfnvedymdkkearkmdrftqyavvaakmavedadlnitdeiaprvgvwvgs
    gfggletlesqfeifltkgprrvspffvpmmipdmatgqisialgakgvnsctvtacatg
    tnsigdafkviqrgdadvmvtggteapltrmsfagfsankalstnpdpktasrpfdknrd
    gfvmgegagiivleelehalargakiygeivgygstgdayhitapaqdgeggaramqeai
    kdagiapeeidyinahgtstyyndkyetmaiktvfgehahklavsstksmtghllgaagg
    ieaifsilaikegvipptiniqtpdeecdldyvpdearrqelnyvlsnslgfgghnatli
    fkkyqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ls6B (B:)
    tkkrvvvtglgalsplgndvdtswnnaingvsgigpitrvdaeeypakvaaelkdfnved
    ymdkkearkmdrftqyavvaakmavedadlnitdeiaprvgvwvgsgfggletlesqfei
    fltkgprrvspffvpmmipdmatgqisialgakgvnsctvtacatgtnsigdafkviqrg
    dadvmvtggteapltrmsfagfsankalstnpdpktasrpfdknrdgfvmgegagiivle
    elehalargakiygeivgygstgdayhitapaqdgeggaramqeaikdagiapeeidyin
    ahgtstyyndkyetmaiktvfgehahklavsstksmtghllgaaggieaifsilaikegv
    ipptiniqtpdeecdldyvpdearrqelnyvlsnslgfgghnatlifkkyq