PDB entry 4ls5

View 4ls5 on RCSB PDB site
Description: Crystal structure of beta-ketoacyl-ACP synthase II (FabF) from Bacillus subtilis
Class: Transferase
Keywords: KASII, KETOACYL SYNTHASE, CONDENSING ENZYME, FATTY ACID ELONGATION, Transferase
Deposited on 2013-07-22, released 2014-04-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-06-04, with a file datestamp of 2014-05-30.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.162
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 2
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: fabF, yjaY, BSU11340
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ls5a1, d4ls5a2
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 2
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: fabF, yjaY, BSU11340
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ls5b1, d4ls5b2
  • Heterogens: K, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ls5A (A:)
    mrgshhhhhhgiqmtkkrvvvtglgalsplgndvdtswnnaingvsgigpitrvdaeeyp
    akvaaelkdfnvedymdkkearkmdrftqyavvaakmavedadlnitdeiaprvgvwvgs
    giggletlesqfeifltkgprrvspffvpmmipdmatgqisialgakgvnsctvtacatg
    tnsigdafkviqrgdadvmvtggteapltrmsfagfsankalstnpdpktasrpfdknrd
    gfvmgegagiivleelehalargakiygeivgygstgdayhitapaqdgeggaramqeai
    kdagiapeeidyinahgtstyyndkyetmaiktvfgehahklavsstksmtghllgaagg
    ieaifsilaikegvipptiniqtpdeecdldyvpdearrqelnyvlsnslgfgghnatli
    fkkyqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ls5A (A:)
    mtkkrvvvtglgalsplgndvdtswnnaingvsgigpitrvdaeeypakvaaelkdfnve
    dymdkkearkmdrftqyavvaakmavedadlnitdeiaprvgvwvgsgiggletlesqfe
    ifltkgprrvspffvpmmipdmatgqisialgakgvnsctvtacatgtnsigdafkviqr
    gdadvmvtggteapltrmsfagfsankalstnpdpktasrpfdknrdgfvmgegagiivl
    eelehalargakiygeivgygstgdayhitapaqdgeggaramqeaikdagiapeeidyi
    nahgtstyyndkyetmaiktvfgehahklavsstksmtghllgaaggieaifsilaikeg
    vipptiniqtpdeecdldyvpdearrqelnyvlsnslgfgghnatlifkkyqs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ls5B (B:)
    mrgshhhhhhgiqmtkkrvvvtglgalsplgndvdtswnnaingvsgigpitrvdaeeyp
    akvaaelkdfnvedymdkkearkmdrftqyavvaakmavedadlnitdeiaprvgvwvgs
    giggletlesqfeifltkgprrvspffvpmmipdmatgqisialgakgvnsctvtacatg
    tnsigdafkviqrgdadvmvtggteapltrmsfagfsankalstnpdpktasrpfdknrd
    gfvmgegagiivleelehalargakiygeivgygstgdayhitapaqdgeggaramqeai
    kdagiapeeidyinahgtstyyndkyetmaiktvfgehahklavsstksmtghllgaagg
    ieaifsilaikegvipptiniqtpdeecdldyvpdearrqelnyvlsnslgfgghnatli
    fkkyqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ls5B (B:)
    mtkkrvvvtglgalsplgndvdtswnnaingvsgigpitrvdaeeypakvaaelkdfnve
    dymdkkearkmdrftqyavvaakmavedadlnitdeiaprvgvwvgsgiggletlesqfe
    ifltkgprrvspffvpmmipdmatgqisialgakgvnsctvtacatgtnsigdafkviqr
    gdadvmvtggteapltrmsfagfsankalstnpdpktasrpfdknrdgfvmgegagiivl
    eelehalargakiygeivgygstgdayhitapaqdgeggaramqeaikdagiapeeidyi
    nahgtstyyndkyetmaiktvfgehahklavsstksmtghllgaaggieaifsilaikeg
    vipptiniqtpdeecdldyvpdearrqelnyvlsnslgfgghnatlifkkyq