PDB entry 4lrw

View 4lrw on RCSB PDB site
Description: Crystal Structure of K-Ras G12C (cysteine-light), GDP-bound
Class: signaling protein
Keywords: GTPase, GDP bound, SIGNALING PROTEIN
Deposited on 2013-07-21, released 2013-11-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.183
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS isoform 2B, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116
      • variant (12)
      • engineered mutation (51)
      • engineered mutation (80)
      • engineered mutation (118)
      • see remark 999 (151)
      • see remark 999 (153)
      • see remark 999 (165-167)
    Domains in SCOPe 2.03: d4lrwa_
  • Chain 'B':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS isoform 2B, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116
      • variant (12)
      • engineered mutation (51)
      • engineered mutation (80)
      • engineered mutation (118)
      • see remark 999 (151)
      • see remark 999 (153)
      • see remark 999 (165-167)
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lrwA (A:)
    gmteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildta
    gqeeysamrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lrwA (A:)
    teyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildtaym
    rtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksdlpsrtvdtkqaqd
    larsygipfietsaktrqgvddafytlvreirkhk
    

  • Chain 'B':
    No sequence available.