PDB entry 4lri

View 4lri on RCSB PDB site
Description: Anti CMV Fab Fragment
Class: Immune System
Keywords: Fab Fragment, CMV neutralizing antibody, glycoprotein H or gH from CMV, Immune System
Deposited on 2013-07-19, released 2014-05-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-02, with a file datestamp of 2014-06-27.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.188
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MSL-109 Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LRI (0-End)
    Domains in SCOPe 2.07: d4lria1, d4lria2
  • Chain 'B':
    Compound: MSL-109 Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LRI (0-End)
    Domains in SCOPe 2.07: d4lrib1, d4lrib2
  • Chain 'C':
    Compound: MSL-109 Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LRI
  • Chain 'P':
    Compound: MSL-109 Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LRI (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lriA (A:)
    divmtqsplslsvtpgepasiscrssqsllhtngynyldwyvqkpgqspqlliylasnra
    sgvpdrfsgsgsgtdftlkisrvetedvgvyycmqalqiprtfgqgtkveikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lriA (A:)
    divmtqsplslsvtpgepasiscrssqsllhtngynyldwyvqkpgqspqlliylasnra
    sgvpdrfsgsgsgtdftlkisrvetedvgvyycmqalqiprtfgqgtkveikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lriB (B:)
    divmtqsplslsvtpgepasiscrssqsllhtngynyldwyvqkpgqspqlliylasnra
    sgvpdrfsgsgsgtdftlkisrvetedvgvyycmqalqiprtfgqgtkveikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lriB (B:)
    divmtqsplslsvtpgepasiscrssqsllhtngynyldwyvqkpgqspqlliylasnra
    sgvpdrfsgsgsgtdftlkisrvetedvgvyycmqalqiprtfgqgtkveikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'C':
    No sequence available.

  • Chain 'P':
    No sequence available.