PDB entry 4lqf

View 4lqf on RCSB PDB site
Description: Structure of murine IgG2b A2C7-Fab in complex with vaccinia antigen A33R at the resolution of 2.3 Angstroms
Class: immune system
Keywords: IgG domain, antibody-antigen complex, Fv, CH1, IgG2b, antigen-binding fragment (Fab), A33R antigen, Papain digest of the mAb, EEV membrane (outer membrane of vaccinia EV form), IMMUNE SYSTEM
Deposited on 2013-07-17, released 2014-08-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: a33r
    Species: Vaccinia virus [TaxId:10245]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q71TT1
      • engineered mutation (29)
      • engineered mutation (34)
      • engineered mutation (51)
  • Chain 'H':
    Compound: Murine IgG2b A2C7 Heavy chain Fab domain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LQF (Start-215)
  • Chain 'L':
    Compound: Murine IgG2b A2C7 Light chain Fab domain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LQF (0-218)
    Domains in SCOPe 2.06: d4lqfl1, d4lqfl2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lqfL (L:)
    dvvmtqtplslpvslgdqasiscrssqslihtngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthippwtfgggtkleikradaapt
    vsifptiseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrne