PDB entry 4lpn

View 4lpn on RCSB PDB site
Description: Frog M-ferritin with cobalt, D127E mutant
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2013-07-16, released 2014-07-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.16
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798
      • engineered mutation (127)
    Domains in SCOPe 2.05: d4lpna_
  • Heterogens: CO, CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lpnA (A:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcefleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lpnA (A:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcefleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk