PDB entry 4lpf

View 4lpf on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis imidazole glycerol phosphate dehydratase in complex with an inhibitor
Class: lyase
Keywords: Dehydratase, LYASE
Deposited on 2013-07-16, released 2013-08-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.188
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Imidazoleglycerol-phosphate dehydratase
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: hisB, RVBD_1601
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4lpfa1, d4lpfa2
  • Heterogens: 3TR, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lpfA (A:)
    mhhhhhhtttqtakasrrarierrtresdivieldldgtgqvavdtgvpfydhmltalgs
    hasfdltvratgdveieahhtiedtaialgtalgqalgdkrgirrfgdafipmdetlaha
    avdlsgrpycvhtgepdhlqhttiagssvpyhtvinrhvfeslaanarialhvrvlygrd
    phhiteaqykavaralrqavepdprvsgvpstkgal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lpfA (A:)
    srrarierrtresdivieldldgtgqvavdtgvpfydhmltalgshasfdltvratgdve
    ieahhtiedtaialgtalgqalgdkrgirrfgdafipmdetlahaavdlsgrpycvhtge
    pdhlqhttiagssvpyhtvinrhvfeslaanarialhvrvlygrdphhiteaqykavara
    lrqavepdpr