SCOPe 2.06: Structural Classification of Proteins

PDB entry 4lnn

View 4lnn on RCSB PDB site
Description: B. subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: structure of apo form of GS
Class: ligase
Keywords: glutamine synthetase, enzyme, dodecamer, alpha/beta, LIGASE
Deposited on 2013-07-11, released 2013-11-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.217
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: glutamine synthetase
Species: Bacillus subtilis [TaxId:1423]
Gene: glnA, BSU17460
Database cross-references and differences (RAF-indexed):
- Uniprot P12425 (0-442)
Domains in SCOPe 2.06: d4lnna1, d4lnna2
Chain 'B':
Compound: glutamine synthetase
Species: Bacillus subtilis [TaxId:1423]
Gene: glnA, BSU17460
Database cross-references and differences (RAF-indexed):
- Uniprot P12425 (0-442)
Domains in SCOPe 2.06: d4lnnb1, d4lnnb2
Chain 'C':
Compound: glutamine synthetase
Species: Bacillus subtilis [TaxId:1423]
Gene: glnA, BSU17460
Database cross-references and differences (RAF-indexed):
- Uniprot P12425 (0-442)
Domains in SCOPe 2.06: d4lnnc1, d4lnnc2
Chain 'D':
Compound: glutamine synthetase
Species: Bacillus subtilis [TaxId:1423]
Gene: glnA, BSU17460
Database cross-references and differences (RAF-indexed):
- Uniprot P12425 (0-442)
Domains in SCOPe 2.06: d4lnnd1, d4lnnd2
Chain 'E':
Compound: glutamine synthetase
Species: Bacillus subtilis [TaxId:1423]
Gene: glnA, BSU17460
Database cross-references and differences (RAF-indexed):
- Uniprot P12425 (0-442)
Domains in SCOPe 2.06: d4lnne1, d4lnne2
Chain 'F':
Compound: glutamine synthetase
Species: Bacillus subtilis [TaxId:1423]
Gene: glnA, BSU17460
Database cross-references and differences (RAF-indexed):
- Uniprot P12425 (0-442)
Domains in SCOPe 2.06: d4lnnf1, d4lnnf2
Chain 'G':
Compound: glutamine synthetase
Species: Bacillus subtilis [TaxId:1423]
Gene: glnA, BSU17460
Database cross-references and differences (RAF-indexed):
- Uniprot P12425 (0-442)
Domains in SCOPe 2.06: d4lnng1, d4lnng2
Chain 'H':
Compound: glutamine synthetase
Species: Bacillus subtilis [TaxId:1423]
Gene: glnA, BSU17460
Database cross-references and differences (RAF-indexed):
- Uniprot P12425 (0-442)
Domains in SCOPe 2.06: d4lnnh1, d4lnnh2
Chain 'I':
Compound: glutamine synthetase
Species: Bacillus subtilis [TaxId:1423]
Gene: glnA, BSU17460
Database cross-references and differences (RAF-indexed):
- Uniprot P12425 (0-442)
Domains in SCOPe 2.06: d4lnni1, d4lnni2
Chain 'J':
Compound: glutamine synthetase
Species: Bacillus subtilis [TaxId:1423]
Gene: glnA, BSU17460
Database cross-references and differences (RAF-indexed):
- Uniprot P12425 (0-442)
Domains in SCOPe 2.06: d4lnnj1, d4lnnj2
Chain 'K':
Compound: glutamine synthetase
Species: Bacillus subtilis [TaxId:1423]
Gene: glnA, BSU17460
Database cross-references and differences (RAF-indexed):
- Uniprot P12425 (0-442)
Domains in SCOPe 2.06: d4lnnk1, d4lnnk2
Chain 'L':
Compound: glutamine synthetase
Species: Bacillus subtilis [TaxId:1423]
Gene: glnA, BSU17460
Database cross-references and differences (RAF-indexed):
- Uniprot P12425 (0-442)
Domains in SCOPe 2.06: d4lnnl1, d4lnnl2
Heterogens: MG, SO4, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4lnnA (A:)
akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
eiewdmfrtqvhpwereqymsqy