PDB entry 4lnf

View 4lnf on RCSB PDB site
Description: B. subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: structure of GS-Q
Class: ligase
Keywords: glutamine synthetase, GS, enzyme, alpha-beta, TnrA, GlnR-DNA, LIGASE
Deposited on 2013-07-11, released 2013-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.195
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnfa1, d4lnfa2
  • Chain 'B':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnfb1, d4lnfb2
  • Chain 'C':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnfc1, d4lnfc2
  • Chain 'D':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnfd1, d4lnfd2
  • Chain 'E':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnfe1, d4lnfe2
  • Chain 'F':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnff1, d4lnff2
  • Chain 'G':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnfg1, d4lnfg2
  • Chain 'H':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnfh1, d4lnfh2
  • Chain 'I':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnfi1, d4lnfi2
  • Chain 'J':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnfj1, d4lnfj2
  • Chain 'K':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnfk1, d4lnfk2
  • Chain 'L':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnfl1, d4lnfl2
  • Heterogens: MG, GLN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lnfA (A:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lnfB (B:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lnfC (C:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lnfD (D:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lnfE (E:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lnfF (F:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lnfG (G:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lnfH (H:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lnfI (I:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4lnfJ (J:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lnfJ (J:)
    ytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfvri
    eesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemedlg
    fsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgfei
    eashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvngsg
    mhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvpgy
    eapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknkle
    apapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieakei
    ewdmfrtqvhpwereqymsqy
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lnfK (K:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lnfL (L:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy