PDB entry 4ln2

View 4ln2 on RCSB PDB site
Description: The second SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin
Class: signaling protein
Keywords: sh3 domain, cell migration, focal adhesion, SIGNALING PROTEIN
Deposited on 2013-07-11, released 2014-05-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.14
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sorbin and SH3 domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA0894, KIAA1296, SH3D5, SORBS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BX66 (3-67)
      • expression tag (2)
    Domains in SCOPe 2.06: d4ln2a1, d4ln2a2
  • Chain 'B':
    Compound: proline rich peptide
    Species: Homo sapiens [TaxId:9606]
    Gene: VCL
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4ln2A (A:)
qhmvleygeaiakfnfngdtqvemsfrkgeritllrqvdenwyegripgtsrqgifpity
vdvikrpl

    Sequence, based on observed residues (ATOM records): (download) 
    >4ln2A (A:)
mvleygeaiakfnfngdtqvemsfrkgeritllrqvdenwyegripgtsrqgifpityvd
vikrpl

  • Chain 'B':
    No sequence available.